PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G113800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 181aa    MW: 20182.3 Da    PI: 9.5831
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G113800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.65e-122569147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rW ++E++++++a  ++G + Wk+I + +  ++t  q++s+ qk+
  Seita.9G113800.1.p 25 RERWAADEHDRFLHALVLFGRD-WKRIEAFVA-TKTSTQIRSHAQKH 69
                        78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-141975IPR009057Homeodomain-like
PROSITE profilePS5129415.5662074IPR017930Myb domain
TIGRFAMsTIGR015571.2E-152472IPR006447Myb domain, plants
SMARTSM007171.4E-72472IPR001005SANT/Myb domain
PfamPF002492.7E-92569IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-62569IPR009057Homeodomain-like
CDDcd001671.40E-62770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MPAAARSIVM AGKKTRKPYT ITRPRERWAA DEHDRFLHAL VLFGRDWKRI EAFVATKTST  60
QIRSHAQKHF LKAQKLGITP PPPHPRLAAV LAQPPVSCPP AWFPGDAMAR SDETLIQLPL  120
SPDELYFAQV YRFVGDIFGS DAPQPVETQL QRLVGADPVI VDTILRVLGN LEENLSLWDV  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981960.11e-130PREDICTED: protein REVEILLE 8-like
SwissprotQ8RWU33e-28RVE8_ARATH; Protein REVEILLE 8
TrEMBLC5WQB48e-73C5WQB4_SORBI; Putative uncharacterized protein Sb01g012460
STRINGSb01g012460.12e-72(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-29MYB_related family protein